Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d033551_circ_g.1 |
ID in PlantcircBase | zma_circ_006889 |
Alias | Zm01circ00166, zma_circ_0000510, ZmciR41 |
Organism | Zea mays |
Position | chr1: 266937823-266938289 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d033551 |
Parent gene annotation |
Phosphoglycerate mutase-like family protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d033551_T044:2 Zm00001d033551_T023:2 Zm00001d033551_T008:2 Zm00001d033551_T002:2 Zm00001d033551_T024:2 Zm00001d033551_T018:2 Zm00001d033551_T030:2 Zm00001d033551_T006:2 Zm00001d033551_T045:2 Zm00001d033551_T010:2 Zm00001d033551_T034:2 Zm00001d033551_T001:2 Zm00001d033551_T033:2 Zm00001d033551_T031:2 Zm00001d033551_T019:2 Zm00001d033551_T037:2 Zm00001d033551_T013:2 Zm00001d033551_T004:2 Zm00001d033551_T025:2 Zm00001d033551_T028:2 Zm00001d033551_T042:2 Zm00001d033551_T022:2 Zm00001d033551_T036:2 Zm00001d033551_T015:2 Zm00001d033551_T040:2 Zm00001d033551_T046:2 Zm00001d033551_T014:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.209137482 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
266938237-266938286(+) |
Potential amino acid sequence |
MIYYPSSAGGGMKELFRKHLEKYGIPVPSYALVNREYPDQELDYFIEQEDFVEVHGKRFLKPFV EKPVNGDDHRIMIYYPSSAGGGMKELFRKHLEKYGIPVPSYALVNREYPDQELDYFIEQEDFVE VHGKRFLKPFVEKPVNGDDHRIMIYYPSSAGGGMKELFRKHLEKYGIPVPSYALVNREYPDQEL DYFIEQEDFVEVHGKRFLKPFVEKPVNGDDHRIMIYYPSSAGGGMKELFRK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |