Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0585200_circ_g.1 |
| ID in PlantcircBase | osa_circ_025010 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 29567615-29567892 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0585200 |
| Parent gene annotation |
Similar to Glutamate receptor. (Os04t0585200-01);Similar to Glut amate receptor 3.1. (Os04t0585200-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0585200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005691* |
| PMCS | 0.33085033 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29567672-29567824(+) 29567735-29567876(-) |
| Potential amino acid sequence |
MFKHPNYCPYDKKEQSSDGPHLDREWLQKGPSTRVLPLNRGKDHKPRRHIWLSEINNLCSICDD SYIAYHSIKVQNTVISCFAGGPRNSSLILCSSIQTTVPMIRKNSPVTVHILIVNGCRKAHPPEF CLLTEVRTTSPDDTYG*(+) MWTVTGLFFLIIGTVVWMLEHRINDEFRGPPAKQLITVFWTLMLW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |