Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0585200_circ_g.1 |
ID in PlantcircBase | osa_circ_025010 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 29567615-29567892 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0585200 |
Parent gene annotation |
Similar to Glutamate receptor. (Os04t0585200-01);Similar to Glut amate receptor 3.1. (Os04t0585200-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0585200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005691* |
PMCS | 0.33085033 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29567672-29567824(+) 29567735-29567876(-) |
Potential amino acid sequence |
MFKHPNYCPYDKKEQSSDGPHLDREWLQKGPSTRVLPLNRGKDHKPRRHIWLSEINNLCSICDD SYIAYHSIKVQNTVISCFAGGPRNSSLILCSSIQTTVPMIRKNSPVTVHILIVNGCRKAHPPEF CLLTEVRTTSPDDTYG*(+) MWTVTGLFFLIIGTVVWMLEHRINDEFRGPPAKQLITVFWTLMLW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |