Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G26330_circ_g.9 |
| ID in PlantcircBase | ath_circ_014950 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 11210920-11211348 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT2G26330 |
| Parent gene annotation |
LRR receptor-like serine/threonine-protein kinase ERECTA |
| Parent gene strand | - |
| Alternative splicing | AT2G26330_circ_g.5 AT2G26330_circ_g.6 AT2G26330_circ_g.7 AT2G26330_circ_g.8 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G26330.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.156334577 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11211129-11210922(-) |
| Potential amino acid sequence |
MTYLNLSSNNIKGPIPVELSRIGNLDTLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIP RAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLNVANNDLEGPIPDHLSSCTNLNSLNVHG NKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLNVANNDLEGPIPDHLSSCTN LNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDT(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |