Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G183500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000508 |
| Alias | Chr05:53594770|53594874 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 53594770-53594874 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G183500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.005G183500.5:1 Gorai.005G183500.1:1 Gorai.005G183500.4:1 Gorai.005G183500.3:1 Gorai.005G183500.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.540480873 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
53594830-53594871(+) 53594842-53594772(-) |
| Potential amino acid sequence |
MITHLPLCSIPNPKKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVLDGVIQLTERD ECAYQEMITHLPLCSIPNPKKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKK(+) MSDHLLICTFISLCELNHTIQNKNLLRIWNGAKWKMSDHLLICTFISLCELNHTIQNKNLLRIW NGAKWKMSDHLLICTFISLCELNHTIQNKNLLRIWNGAKWKMSDHLLICTFISLCELNHTIQNK N(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |