Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G26555_circ_g.2 |
ID in PlantcircBase | ath_circ_032950 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 13405230-13405465 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT4G26555 |
Parent gene annotation |
Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G26555.2:2 AT4G26555.1:2 AT4G26555.3:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.145127118 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13405461-13405462(+) |
Potential amino acid sequence |
MSYERNIHLHADTHSLVRPGPLHELLVLHLQLSLDTSRHSGVSMSYERNIHLHADTHSLVRPGP LHELLVLHLQLSLDTSRHSGVSMSYERNIHLHADTHSLVRPGPLHELLVLHLQLSLDTSRHSGV SM(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |