Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G042100_circ_g.1 |
| ID in PlantcircBase | gra_circ_000444 |
| Alias | Chr05:4006340|4006724 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 4006340-4006724 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G042100 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.005G042100.5:1 Gorai.005G042100.3:1 Gorai.005G042100.1:1 Gorai.005G042100.4:1 Gorai.005G042100.2:1 Gorai.005G042100.6:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000701 |
| PMCS | 0.501344069 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4006622-4006718(-) |
| Potential amino acid sequence |
MYRGFVSELFVPYMDLTEEWYYRTFFDAGEYGYGLCAVPLEPLRDCPANAVYMGAYVAAQNGMP IEMPNVFCIFERNAGDVMWRHTETMIPPDLVG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |