Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0190500_circ_g.2 |
| ID in PlantcircBase | osa_circ_013580 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 5026836-5026975 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0190500 |
| Parent gene annotation |
Serine/threonine protein kinase-related domain containing protei n. (Os02t0190500-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0190500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.662863571 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5026888-5026905(+) 5026890-5026970(-) |
| Potential amino acid sequence |
MSGIYTVKSDVYSFGVVMLELLTGRKPLDRFQLRCLAHLDTVPRSLPCQEFIP*(+) MANSGALYPNEPNTSVETCLVVSALSIALTSQLQNCTHHSLRYKFLTWQTPGHCIQMSQTPQLK PV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |