Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0101800_circ_g.2 |
| ID in PlantcircBase | osa_circ_010256 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 81999-82181 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os12g0101800 |
| Parent gene annotation |
Similar to Nonphototrophic hypocotyl 1a. (Os12t0101800-01);Simil ar to Nonphototrophic hypocotyl 1a. (Os12t0101800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 12 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0101800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.162112933 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
82152-82129(+) 82034-82131(-) |
| Potential amino acid sequence |
MRTAGSSSSSAASFKALAPTPMRLTRSGNPSQMAPTIVAASSTTRRTARHSGTS*(+) MGVGARALKEAADELEEPAVLILDRGNG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |