Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0101800_circ_g.2 |
ID in PlantcircBase | osa_circ_010256 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 81999-82181 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os12g0101800 |
Parent gene annotation |
Similar to Nonphototrophic hypocotyl 1a. (Os12t0101800-01);Simil ar to Nonphototrophic hypocotyl 1a. (Os12t0101800-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 12 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0101800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.162112933 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
82152-82129(+) 82034-82131(-) |
Potential amino acid sequence |
MRTAGSSSSSAASFKALAPTPMRLTRSGNPSQMAPTIVAASSTTRRTARHSGTS*(+) MGVGARALKEAADELEEPAVLILDRGNG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |