Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G55820_circ_g.4 |
| ID in PlantcircBase | ath_circ_044265 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 22590411-22590599 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI, PcircRNA_finder, circseq_cup, find_circ |
| Parent gene | AT5G55820 |
| Parent gene annotation |
Inner centromere protein, ARK-binding region protein |
| Parent gene strand | + |
| Alternative splicing | AT5G55820_circ_g.2 AT5G55820_circ_g.3 |
| Support reads | 13 |
| Tissues | root, aerial, inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G55820.10:1 AT5G55820.8:1 AT5G55820.1:1 AT5G55820.11:1 AT5G55820.4:1 AT5G55820.9:1 AT5G55820.5:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.749010048 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22590558-22590596(+) |
| Potential amino acid sequence |
MIGSASSAELRFEEGDILESDYVREAVHHREEAACHNVDNYDVELQKLIGSASSHHYSVELQKM IGSASSAELRFEEGDILESDYVREAVHHREEAACHNVDNYDVELQKLIGSASSHHYSVELQKMI GSASSAELRFEEGDILESDYVREAVHHREEAACHNVDNYDVELQKLIGSASSHHYSVELQKMIG SASSAELRFEE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |