Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0157300_circ_g.1 |
| ID in PlantcircBase | osa_circ_026695 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 3349975-3350254 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0157300 |
| Parent gene annotation |
4Fe-4S ferredoxin, iron-sulpur binding domain domain containing protein. (Os05t0157300-01);Similar to 4Fe-4S ferredoxin, iron-su lfur binding protein. (Os05t0157300-02);Similar to 4Fe-4S ferred oxin, iron-sulfur binding protein. (Os05t0157300-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0157300-03:2 Os05t0157300-02:2 Os05t0157300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.194696637 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3350030-3350051(+) 3350227-3350011(+) 3350241-3350165(-) |
| Potential amino acid sequence |
MSWCHQPTDRSQEAYLTLKTNEQQRILFPSLHLGLCRHSSAGHLTGKVVDWKRPAFFRDSMVYE LVPPAN*(+) MSPLIGRPSNRKSCRLEKTSFL*(+) MSGDIGRGATRETVSFAVHLSSMSNRPPGFYQLAGGTNSYTIESLKKAGLFQSTTFPVRWPADE WRHRPRCNEGNSILCCSFVFNVK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |