Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0326700_circ_g.3 |
| ID in PlantcircBase | osa_circ_014492 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 13157436-13157953 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0326700 |
| Parent gene annotation |
Peptidase S54, rhomboid domain containing protein. (Os02t0326700 -01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0326700_circ_g.4 Os02g0326700_circ_g.5 Os02g0326700_circ_g.6 Os02g0326700_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0326700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011612 |
| PMCS | 0.21032175 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13157444-13157440(+) 13157895-13157477(+) |
| Potential amino acid sequence |
MAGVIKWKMMSCEQSGRRSAEIARECLSLTPNRYKCHSYQHIGYLGDSAEGFICRPLKSKLRSK VGLHVAAKVHNKDDEGSCSSRISDEDNETLSNASRKMEVNHLGALRCYFSKLNTEDAQKPYSFH QTNKQRTGPLSTNIEEANMATDYGDFRNTLESFEINFNRRKKGI*(+) MAISGIRWNHSRSTSTDEKKVSNGWGHKMENDVM*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |