Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0326700_circ_g.3 |
ID in PlantcircBase | osa_circ_014492 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 13157436-13157953 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0326700 |
Parent gene annotation |
Peptidase S54, rhomboid domain containing protein. (Os02t0326700 -01) |
Parent gene strand | + |
Alternative splicing | Os02g0326700_circ_g.4 Os02g0326700_circ_g.5 Os02g0326700_circ_g.6 Os02g0326700_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0326700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011612 |
PMCS | 0.21032175 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13157444-13157440(+) 13157895-13157477(+) |
Potential amino acid sequence |
MAGVIKWKMMSCEQSGRRSAEIARECLSLTPNRYKCHSYQHIGYLGDSAEGFICRPLKSKLRSK VGLHVAAKVHNKDDEGSCSSRISDEDNETLSNASRKMEVNHLGALRCYFSKLNTEDAQKPYSFH QTNKQRTGPLSTNIEEANMATDYGDFRNTLESFEINFNRRKKGI*(+) MAISGIRWNHSRSTSTDEKKVSNGWGHKMENDVM*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |