Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0327300_circ_g.1 |
| ID in PlantcircBase | osa_circ_006463 |
| Alias | Os_ciR6997 |
| Organism | Oryza sativa |
| Position | chr10: 9123034-9123772 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0327300 |
| Parent gene annotation |
Similar to Phosphatidate cytidylyltransferase (EC 2.7.7.41). (Os 10t0327300-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0327325-00:1 Os10t0327300-01:2 Os10t0327325-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.228727244 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9123069-9123048(+) 9123635-9123688(-) |
| Potential amino acid sequence |
MKLASTNAESMVVTDAPRKPSQVFFGESLIKGVFPKKKPKKYAATSLIAIKEAGRRNLSGAC*( +) MLSAFVLANFMGHFQWLTCPRKVPPTSFFDRYQRCCCIFLRLLLWENTLN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |