Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0126400_circ_g.3 |
| ID in PlantcircBase | osa_circ_012908 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 1390840-1391319 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0126400 |
| Parent gene annotation |
Calcium-dependent protein kinase, Positive regulator of the salt and drought stress responses (Os02t0126400-01);Similar to Calci um-dependent protein kinase. (Os02t0126400-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0126400-01:3 Os02t0126400-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.257101233 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1391077-1391112(+) |
| Potential amino acid sequence |
MLKVAAECHLHGLVHRDMKPENFLFKSTKEDSPLKATDFGLSDFIKPDYVRVVNYWTGFWQKRT AVIVRKMLQWWCGRCSKWQLSAICMG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |