Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0701800_circ_g.1 |
ID in PlantcircBase | osa_circ_021136 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 28183133-28183298 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0701800 |
Parent gene annotation |
Similar to Phosphatidylinositol-4-phosphate 5-kinase 1. (Os03t07 01800-01);Similar to Isoform 2 of Phosphatidylinositol-4-phospha te 5-kinase 1. (Os03t0701800-02) |
Parent gene strand | + |
Alternative splicing | Os03g0701800_circ_g.2 Os03g0701800_circ_g.3 Os03g0701800_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0701800-01:1 Os03t0701800-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.586351205 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28183147-28183192(+) |
Potential amino acid sequence |
MFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRKTELKESSRNVSYRCCRL HDVYMWW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |