Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0109201_circ_g.2 |
| ID in PlantcircBase | osa_circ_000102 |
| Alias | Os_ciR6538 |
| Organism | Oryza sativa |
| Position | chr1: 502356-502559 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0109201 |
| Parent gene annotation |
Hypothetical gene. (Os01t0109201-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0109201_circ_g.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0109300-01:2 Os01t0109201-01:2 Os01t0109300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.370781863 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
502387-502395(+) 502485-502372(+) 502492-502507(-) 502526-502511(-) |
| Potential amino acid sequence |
MQTVKLAGLLHDIGHGPFSHLFEHEFLPRVVPGSTWEKSLALTVLICKL*(+) MTLDMAPSVICLNMSFFLVLFLDQPGRRAWH*(+) MSCKRPASFTVCISTRSMPSSSPRLIQEQHEEETHVQTND*(-) MFKQMTEGAMSNVMQKACKFYSLHINTVNAKLFSQVDPGTTRGRNSCSNK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |