Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0109201_circ_g.2 |
ID in PlantcircBase | osa_circ_000102 |
Alias | Os_ciR6538 |
Organism | Oryza sativa |
Position | chr1: 502356-502559 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os01g0109201 |
Parent gene annotation |
Hypothetical gene. (Os01t0109201-01) |
Parent gene strand | - |
Alternative splicing | Os01g0109201_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0109300-01:2 Os01t0109201-01:2 Os01t0109300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.370781863 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
502387-502395(+) 502485-502372(+) 502492-502507(-) 502526-502511(-) |
Potential amino acid sequence |
MQTVKLAGLLHDIGHGPFSHLFEHEFLPRVVPGSTWEKSLALTVLICKL*(+) MTLDMAPSVICLNMSFFLVLFLDQPGRRAWH*(+) MSCKRPASFTVCISTRSMPSSSPRLIQEQHEEETHVQTND*(-) MFKQMTEGAMSNVMQKACKFYSLHINTVNAKLFSQVDPGTTRGRNSCSNK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |