Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G64390_circ_g.1 |
ID in PlantcircBase | ath_circ_008617 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 23911724-23911936 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G64390 |
Parent gene annotation |
Endoglucanase 6 |
Parent gene strand | + |
Alternative splicing | AT1G64390_circ_g.2 AT1G64390_circ_g.3 AT1G64390_circ_g.4 |
Support reads | 19 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G64390.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.404390684 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23911781-23911933(+) |
Potential amino acid sequence |
MAFTVTMMAWSVIEYGNQLQANGELGNSIDAIKWGTDYFIKAHPEPNVLYGEVNLVGGYYDAGD NVKFGLPMAFTVTMMAWSVIEYGNQLQANGELGNSIDAIKWGTDYFIKAHPEPNVLYGEVNLVG GYYDAGDNVKFGLPMAFTVTMMAWSVIEYGNQLQANGELGNSIDAIKWGTDYFIKAHPEPNVLY GEVNLVGGYYDAGDNVKFGLPMAFTVTMMAWSVIEYGNQLQANGELGNSIDAIKWGTDYFIKAH PEPNVLYGE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |