Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G29030_circ_g.2 |
ID in PlantcircBase | ath_circ_004744 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 10129885-10130214 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G29030 |
Parent gene annotation |
Apoptosis inhibitory protein 5 (API5) |
Parent gene strand | - |
Alternative splicing | AT1G29030_circ_g.1 AT1G29030_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G29030.1:2 AT1G29030.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.27671032 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10129966-10129887(-) |
Potential amino acid sequence |
MKKLTQGMSEHSKAMSTAKTDEEKSIVAPNATNSLCGYKIVTGQPSDRLGEDFSEFNKEFTERL TSVEDLTKATMKKLTQGMSEHSKAMSTAKTDEEKSIVAPNATNSLCGYKIVTGQPSDRLGEDFS EFNKEFTERLTSVEDLTKATMKKLTQGMSEHSKAMSTAKTDEEKSIVAPNATNSLCGYKIVTGQ PSDRLGEDFSEFNKEFTERLTSVEDLTKATMKKLTQGMSEHSKAMSTAKTDEEKSIV(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |