Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d047309_circ_g.2 |
ID in PlantcircBase | zma_circ_010036 |
Alias | Zm09circ00059, GRMZM2G171428_C1 |
Organism | Zea mays |
Position | chr9: 126277956-126278876 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d047309 |
Parent gene annotation |
Putative WRKY DNA-binding domain superfamily protein |
Parent gene strand | + |
Alternative splicing | Zm00001d047309_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d047309_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.338863869 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
126277969-126277986(+) |
Potential amino acid sequence |
MSHQQALAQVTAQAVHSQYNMINHTDYSIPFSSTTAPALITAQHANSSANVASAQEKPALPSHA GNSNIESNEVSQGLKTSAPTFDKPADDGYNWRKYGQKAVKGGEYPRSYYKCTHTSCPVKKKVER SAEGHITQIIYRGQHNHQRPPKRRSKDGGGPLNEADVLHENEDISTRSEPGSQEHSGKHEGSND GILGPSVSRRGGGDEQLSGSSDSDEEQDDEQRAGDEDPGYANANKRHVPTPAQRIIVQTNSEVD LLDDGYRWRKYGQKVVKGNPYPRGVLRCPINKP*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |