Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0171300_circ_g.2 |
| ID in PlantcircBase | osa_circ_032933 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 3775968-3776497 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os07g0171300 |
| Parent gene annotation |
Protein kinase, core domain containing protein. (Os07t0171300-01 ) |
| Parent gene strand | + |
| Alternative splicing | Os07g0171300_circ_g.1 Os07g0171300_circ_g.3 |
| Support reads | 2 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0171300-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017574 |
| PMCS | 0.192301148 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3776283-3775974(+) 3776128-3776188(-) |
| Potential amino acid sequence |
MDMLGPSLWDVWNSLGQTMSPHMGACIAVEAISILEKLHSKGLH*(+) MVNLPLIGGTIIAPFTVSMLKLQCNPLEWSFSRIEMASTAMQAPICGDIVCPNEFHTSQRLGPS ISMTRI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |