Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0171300_circ_g.2 |
ID in PlantcircBase | osa_circ_032933 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 3775968-3776497 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os07g0171300 |
Parent gene annotation |
Protein kinase, core domain containing protein. (Os07t0171300-01 ) |
Parent gene strand | + |
Alternative splicing | Os07g0171300_circ_g.1 Os07g0171300_circ_g.3 |
Support reads | 2 |
Tissues | shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0171300-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017574 |
PMCS | 0.192301148 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3776283-3775974(+) 3776128-3776188(-) |
Potential amino acid sequence |
MDMLGPSLWDVWNSLGQTMSPHMGACIAVEAISILEKLHSKGLH*(+) MVNLPLIGGTIIAPFTVSMLKLQCNPLEWSFSRIEMASTAMQAPICGDIVCPNEFHTSQRLGPS ISMTRI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |