Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0108500_circ_g.1 |
ID in PlantcircBase | osa_circ_017492 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 500457-500755 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0108500 |
Parent gene annotation |
Similar to 4,4-dimethyl-sterol C4-methyl-oxidase (Fragment). (Os 03t0108500-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0108500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.261082414 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
500476-500639(+) 500716-500695(-) |
Potential amino acid sequence |
MVSVASVSPVDVITESEDRREVALAVSSHEMVVVMVLHSSIQRDILGRIERQLEPLTSLPYGIC SLCQSRRCNHRK*(+) MEEWSTMTTTISWEDTARATSLLSSLSVITSTGLTEATDTIRQACQRFKLPFDPTKYIPLYGGV EYHDYHHFVGGHSQSNFSSVFTFCDYIYGTDRGYRYHKASLSKVQVAVRSDQVYPVVWRSGVP* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |