Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0108500_circ_g.1 |
| ID in PlantcircBase | osa_circ_017492 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 500457-500755 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0108500 |
| Parent gene annotation |
Similar to 4,4-dimethyl-sterol C4-methyl-oxidase (Fragment). (Os 03t0108500-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0108500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.261082414 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
500476-500639(+) 500716-500695(-) |
| Potential amino acid sequence |
MVSVASVSPVDVITESEDRREVALAVSSHEMVVVMVLHSSIQRDILGRIERQLEPLTSLPYGIC SLCQSRRCNHRK*(+) MEEWSTMTTTISWEDTARATSLLSSLSVITSTGLTEATDTIRQACQRFKLPFDPTKYIPLYGGV EYHDYHHFVGGHSQSNFSSVFTFCDYIYGTDRGYRYHKASLSKVQVAVRSDQVYPVVWRSGVP* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |