Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0595100_circ_g.4 |
| ID in PlantcircBase | osa_circ_029234 |
| Alias | Os_ciR1243 |
| Organism | Oryza sativa |
| Position | chr5: 29634256-29634357 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0595100 |
| Parent gene annotation |
Uridine-diphospho-(UDP)-glucose 4-epimerase, Cell wall carbohydr ate partitioning during nitrogen (N) limitation (Os05t0595100-01 ) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 15/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0595100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.437058987 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29634335-29634354(+) 29634273-29634258(-) |
| Potential amino acid sequence |
MNPYGRTKLVFSSSATVYGWPKEVPCTEESPLCAMNPYGRTKLVFSSSATVYGWPKEVPCTEES PLCAMNPYGRTKLVFSSSATVYGWPKEVPCTEESPLCAMNPYGRTK(+) MMRTPALFCRRGSLHKVGILQCRAPPWATRRQLRMMRTPALFCRRGSLHKVGILQCRAPPWATR RQLRMMRTPALFCRRGSLHKVGILQCRAPPWATRRQLRMMRTP(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |