Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0602400_circ_g.3 |
| ID in PlantcircBase | osa_circ_041858 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 30401211-30401366 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os04g0602400 |
| Parent gene annotation |
Similar to Maltose excess protein 1, chloroplast precursor (Root cap protein 1). (Os04t0602400-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0602400_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0602400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.237184562 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30401310-30401335(-) 30401219-30401259(-) |
| Potential amino acid sequence |
MSPSSSCSFPRSSSTPVTSSPATKPRSSPSHGSTRRSIRNGTL*(-) MARPEEVSGMGLSDGQVRRRRQCPLPPPAASPDHPQRP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |