Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0135800_circ_g.3 |
| ID in PlantcircBase | osa_circ_026492 |
| Alias | Os_ciR9928 |
| Organism | Oryza sativa |
| Position | chr5: 2099070-2099557 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0135800 |
| Parent gene annotation |
Ser/Thr protein kinase, Negative regulator of innate immunity (O s05t0135800-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0135800_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0135800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.499393784 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2099286-2099126(+) |
| Potential amino acid sequence |
MAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTW EGRVLKELNLVQSYHGHNV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |