Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0421000_circ_g.1 |
| ID in PlantcircBase | osa_circ_020335 |
| Alias | Os03circ17718 |
| Organism | Oryza sativa |
| Position | chr3: 17516176-17520721 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os03g0421000 |
| Parent gene annotation |
Zinc finger, FYVE/PHD-type domain containing protein. (Os03t0421 000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | panicle |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0421000-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013154 |
| PMCS | 0.090301716 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17520251-17516270(+) 17520061-17516274(+) 17516289-17520719(-) |
| Potential amino acid sequence |
MSPLGSNNNVDRHCTEYILPFYLGHDRCHISHKPFHSFTMPKESKRSCRNGTKWHRLMPPLGIH KDTP*(+) MDSIPDSLPTLTRSLVPIGLVLALTTTPFIRNIICHHWEAITMLIDIAPNTFCHSILVMTAATY PTNHFILSLCPRKARGHAEMEPNGIDLCLLLGSTKTPHK*(+) MERATYGVSLWIPRGGISLCHLVPFLHDLLLSLGIVKE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |