Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0421000_circ_g.1 |
ID in PlantcircBase | osa_circ_020335 |
Alias | Os03circ17718 |
Organism | Oryza sativa |
Position | chr3: 17516176-17520721 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os03g0421000 |
Parent gene annotation |
Zinc finger, FYVE/PHD-type domain containing protein. (Os03t0421 000-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | panicle |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0421000-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013154 |
PMCS | 0.090301716 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17520251-17516270(+) 17520061-17516274(+) 17516289-17520719(-) |
Potential amino acid sequence |
MSPLGSNNNVDRHCTEYILPFYLGHDRCHISHKPFHSFTMPKESKRSCRNGTKWHRLMPPLGIH KDTP*(+) MDSIPDSLPTLTRSLVPIGLVLALTTTPFIRNIICHHWEAITMLIDIAPNTFCHSILVMTAATY PTNHFILSLCPRKARGHAEMEPNGIDLCLLLGSTKTPHK*(+) MERATYGVSLWIPRGGISLCHLVPFLHDLLLSLGIVKE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |