Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0436000_circ_g.5 |
ID in PlantcircBase | osa_circ_037169 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 21175712-21176257 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0436000 |
Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os08t0436000-01);Hypothetical conserved gene. (Os08t0436000-02) |
Parent gene strand | - |
Alternative splicing | Os08g0436000_circ_g.2 Os08g0436000_circ_g.3 Os08g0436000_circ_g.4 Os08g0436000_circ_g.6 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0436000-01:4 Os08t0436000-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.176227228 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21176056-21175763(+) 21176246-21175894(+) |
Potential amino acid sequence |
MLLPSNEFFASSAVGASVYWISAWKPAAFSKVAILWTNPNAENTCAIPSIAVGFTGRYGFV*(+ ) MRKIPVRFPRLLLDSQEDMDSCNPCYDVIET*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |