Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0571800_circ_g.1 |
ID in PlantcircBase | osa_circ_015101 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 21895638-21896212 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0571800 |
Parent gene annotation |
Terpene synthase-like domain containing protein. (Os02t0571800-0 0) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0571800-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.12727742 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21896125-21895665(+) 21896127-21896187(-) 21895781-21896210(-) |
Potential amino acid sequence |
MATHAVSYEDGCNWTSLSCFLILSCSSFLCFPIRSSECE*(+) MVPVQGSHQTPRFPQSIEWILQNQYDDGSWGTNLPGLVVNKDILLCTLACVVALKRWNTGRDHI SRGLNFIGRNFSVAMDEQTVAPVGFNITFSGLLSLATRTGLELPVMQTDIDGIIHIRKIELESI RMNCMTR*(-) MSKLLLLWVSTLPFLACLALPLERVWNCLLCKRILMGLFTFGRSNWKA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |