Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0131400_circ_g.5 |
| ID in PlantcircBase | osa_circ_038493 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 2404198-2404366 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0131400 |
| Parent gene annotation |
Hypothetical protein. (Os09t0131400-01);Similar to tobamovirus m ultiplication 3. (Os09t0131400-02);Similar to tobamovirus multip lication 3. (Os09t0131400-03) |
| Parent gene strand | - |
| Alternative splicing | Os09g0131400_circ_g.1 Os09g0131400_circ_g.2 Os09g0131400_circ_g.3 Os09g0131400_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0131400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.227100592 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2404277-2404231(+) 2404204-2404231(+) 2404260-2404322(-) |
| Potential amino acid sequence |
MFLGRSSCLISKSGHQVLDLQYSFRLLLLQKFMQKLQDLHMRKFSICQSAMGRSPNNVSWPFFL SDQQKWSSSLGFAIFIQIAATAKIYAEIAGFAYA*(+) MQKLQDLHMRKFSICQSAMGRSPNNVSWPFFLSDQQKWSSSLGFAIFIQIAATAKIYAEIAGFA YA*(+) MADWQMENLRICKSCNFCINFCSSSNLNEYCKSKT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |