Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0184900_circ_g.2 |
| ID in PlantcircBase | osa_circ_000596 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 4499898-4500589 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0184900 |
| Parent gene annotation |
Similar to SSRP1 protein. (Os01t0184900-01);Similar to SSRP1 pro tein. (Os01t0184900-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0184900_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0184900-02:4 Os01t0184900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.26279021 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4499923-4499901(+) 4500530-4499950(+) |
| Potential amino acid sequence |
MQKNMGLSPDEKQLSVSGQNWGGIDINGNMLTFMVGSKQAFEVSLADVSQTQMQGKTDVLLEFH VDDTTGGNEKDSLMDLSFHVPTSNTQFLGDENRTAAQVLWETIMGVADVDSSEEAVVTFEGIAI LTPRM*(+) MLILLKRQLSPLKELLFLHQGCKQSDQFHAKEYGPLTR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |