Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0513600_circ_g.4 |
| ID in PlantcircBase | osa_circ_039817 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 19994545-19995175 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0513600 |
| Parent gene annotation |
Similar to predicted protein. (Os09t0513600-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0513600_circ_g.1 Os09g0513600_circ_g.2 Os09g0513600_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0513600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.350876756 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19994553-19994577(+) 19994555-19994617(-) |
| Potential amino acid sequence |
MTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEY PPKGVAKVCHDWPVDSEK*(+) MAYLGNPFWGILALQSRVNALFHSVLCQTRCCPCNQTLLTPRHCVIYWFPSC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |