Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G191000_circ_g.1 |
| ID in PlantcircBase | gra_circ_000383 |
| Alias | Chr04:50804319|50806131 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 50804319-50806131 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G191000 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 7 |
| Tissues | ovule |
| Exon boundary | No-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G191000.3:4 Gorai.004G191000.2:4 Gorai.004G191000.1:4 Gorai.004G191000.4:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.595702266 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
50804346-50805939(-) |
| Potential amino acid sequence |
MEVMLLKDQMNLKQTVKSQMLVVLMEMTRLGFHGFATYVEMNSFVKLMMTTSKMILTFVGLAAK FLIMIMHLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |