Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d043275_circ_g.1 |
ID in PlantcircBase | zma_circ_007772 |
Alias | zma_circ_0001282 |
Organism | Zea mays |
Position | chr3: 194098356-194098909 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d043275 |
Parent gene annotation |
Vacuole membrane protein KMS1 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d043275_T001:1 Zm00001d043275_T006:1 Zm00001d043275_T010:2 Zm00001d043275_T005:2 Zm00001d043275_T014:1 Zm00001d043275_T004:2 Zm00001d043275_T009:2 Zm00001d043275_T011:2 Zm00001d043275_T008:1 Zm00001d043275_T003:2 Zm00001d043275_T002:2 Zm00001d043275_T012:2 Zm00001d043275_T013:2 Zm00001d043275_T007:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.095534507 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
194098441-194098837(-) |
Potential amino acid sequence |
MCGQFGVPFWEFLFATLIGKAIIKTHIQLAYQEASQKLFRSLMQLLPKKMGQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |