Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G63310_circ_g.7 |
| ID in PlantcircBase | ath_circ_045513 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 25373130-25373418 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G63310 |
| Parent gene annotation |
Nucleoside diphosphate kinase |
| Parent gene strand | - |
| Alternative splicing | AT5G63310_circ_g.1 AT5G63310_circ_g.2 AT5G63310_circ_g.3 AT5G63310_circ_g.4 AT5G63310_circ_g.5 AT5G63310_circ_g.6 |
| Support reads | 2 |
| Tissues | leaf, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G63310.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.217200228 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25373395-25373132(-) |
| Potential amino acid sequence |
MVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEDVEETYIMVKPDGIQRGLVGEII SRFEKKGFKLIGLKMFQCPKELAEEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMF QCPKELAEEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |