Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0173500_circ_g.1 |
| ID in PlantcircBase | osa_circ_013397 |
| Alias | Os_ciR2588 |
| Organism | Oryza sativa |
| Position | chr2: 4026262-4027318 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0173500 |
| Parent gene annotation |
Similar to Cholinephosphate cytidylyltransferase. (Os02t0173500- 01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0173500_circ_g.2 Os02g0173500_circ_g.3 Os02g0173500_circ_g.4 Os02g0173500_circ_g.5 Os02g0173500_circ_g.6 Os02g0173500_circ_g.7 |
| Support reads | 6/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0173500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.417035186 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4026336-4026267(+) 4026315-4027256(-) |
| Potential amino acid sequence |
MTEDERYESLRHCKWVDEVIPDAPWVVTEEFLNKHNIDFVAHDSLPYADASGAGNDVYEFVKKL GKFKETQRTDGISTSDIIMRIVKDYNEYVMRNLARGYTRKDLGVSYVKEKRLRVNMGLKNLRDK VKQHQEKVGEKVS*(+) MCQLIIAASDKEICVRKPSPLLFLGAASLCHAGFLIPC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |