Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G04650_circ_g.2 |
| ID in PlantcircBase | ath_circ_019699 |
| Alias | AT3G04650_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 1263468-1263677 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, CIRI2 |
| Parent gene | AT3G04650 |
| Parent gene annotation |
AT3g04650/F7O18_13 |
| Parent gene strand | + |
| Alternative splicing | AT3G04650_circ_g.1 |
| Support reads | 6 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G04650.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.573359842 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1263576-1263674(+) |
| Potential amino acid sequence |
MGNNSAKLGNGRTPPHCWTFFSTAAYGKQNKVPQKLDLSSIWALLAAFDDPLPTVNFEGAFVKG VESLSWMGNNSAKLGNGRTPPHCWTFFSTAAYGKQNKVPQKLDLSSIWALLAAFDDPLPTVNFE GAFVKGVESLSWMGNNSAKLGNGRTPPHCWTFFSTAAYGKQNKVPQKLDLSSIWALLAAFDDPL PTVNFEGAFVKGVESLSWMGNNSAKLGNGRTPPHCWTFFSTAAYGKQNKVPQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |