Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | POPTR_0008s09070_circ_g.1 |
ID in PlantcircBase | pop_circ_002338 |
Alias | Chr08:5716098|5717826 |
Organism | Populus trichocarpa |
Position | chr8: 5621349-5623077 JBrowse» |
Reference genome | Populus trichocarpa genome v3.0 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | POPTR_0008s09070 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | stem cambium |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | POPTR_0008s09070.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.104252926 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5623041-5621424(+) 5621396-5622898(-) |
Potential amino acid sequence |
MRDWSNLRYHWQKNITIFLQKGLRIFIHPNLSHISSPS*(+) MNKNTQSFLKKYSYILLPMIPQIAPISHSALSLLTSSHNDPKDQPFFQTIQLAYTSAQMVLIAS EEASCIIALHH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zheng et al., 2020 |