Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0541400_circ_g.1 |
| ID in PlantcircBase | osa_circ_011904 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 21655294-21656592 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os12g0541400 |
| Parent gene annotation |
Conserved hypothetical protein. (Os12t0541400-01);Conserved hypo thetical protein. (Os12t0541400-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0541400-02:2 Os12t0541400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.100077175 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21656567-21656589(+) 21656547-21656542(+) |
| Potential amino acid sequence |
MGRLRGLKERKEELLPVEEKISELDESQSQLMGRLRGLKERKEELLPVEEKISELDESQSQLMG RLRGLKERKEELLPVEEKISELDESQSQLMGRLRGLKE(+) MNHSHSLWGDFGDSRRGRRSCCRWRRRSRN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |