Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0541400_circ_g.1 |
ID in PlantcircBase | osa_circ_011904 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 21655294-21656592 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os12g0541400 |
Parent gene annotation |
Conserved hypothetical protein. (Os12t0541400-01);Conserved hypo thetical protein. (Os12t0541400-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0541400-02:2 Os12t0541400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.100077175 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21656567-21656589(+) 21656547-21656542(+) |
Potential amino acid sequence |
MGRLRGLKERKEELLPVEEKISELDESQSQLMGRLRGLKERKEELLPVEEKISELDESQSQLMG RLRGLKERKEELLPVEEKISELDESQSQLMGRLRGLKE(+) MNHSHSLWGDFGDSRRGRRSCCRWRRRSRN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |