Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G37450_circ_g.2 |
| ID in PlantcircBase | ath_circ_017068 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 15723330-15723491 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G37450 |
| Parent gene annotation |
WAT1-related protein |
| Parent gene strand | - |
| Alternative splicing | AT2G37450_circ_g.1 2_circ_ag.3 AT2G37450_circ_g.4 AT2G37460_circ_g.1 AT2G37460_circ_g.2 |
| Support reads | 9 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G37450.2:1 AT2G37450.1:1 AT2G37450.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.160584466 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15723399-15723332(-) |
| Potential amino acid sequence |
MEKGNPSVWAIGWDTKLLTITYSAITLKTYPAELSLATWICLIGTIEGVVVALVMEKGNPSVWA IGWDTKLLTITYSAITLKTYPAELSLATWICLIGTIEGVVVALVMEKGNPSVWAIGWDTKLLTI TYSAITLKTYPAELSLATWICLIGTIEGVVVALVMEKGNPSVWAIGWDTKLLTITYS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |