Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0324800_circ_g.3 |
| ID in PlantcircBase | osa_circ_019575 |
| Alias | Os_ciR8469 |
| Organism | Oryza sativa |
| Position | chr3: 11809335-11809780 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0324800 |
| Parent gene annotation |
Conserved hypothetical protein. (Os03t0324800-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0324800_circ_g.2 Os03g0324800_circ_g.4 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0324800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.177466611 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11809446-11809734(-) |
| Potential amino acid sequence |
MMEYKTSIEQLKKDSKYTLDKIAVGESDLQRGQTDLRSSEIFIPQYSGAFQD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |