Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc10g039430.1_circ_g.2 |
| ID in PlantcircBase | sly_circ_003096 |
| Alias | 10:21771604|21772311 |
| Organism | Solanum lycopersicum |
| Position | chr10: 21871504-21872211 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc10g039430.1 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc10g039430.1_circ_g.1 |
| Support reads | 5/3 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc10g039430.1.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.43895576 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21871904-21872193(-) 21871522-21872193(-) |
| Potential amino acid sequence |
MFQWVRHYPDGTRQYIEGATNPEYVVTADDIDKLIAVECIPMDDQGHQGCFRSR*(-) MIRDIRDVSGPAKDNLFAINGVNERFEESNNENRHNPPTVGNDIGGSFSSEGESPGIEVFQIIG EAKPGCKLLGCGFPVRGTSLCMFQWVRHYPDGTRQYIEGATNPEYVVTADDIDKLIAVECIPMD DQGHQGCFRSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to chilling stress; fruit ripening |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018 |