Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc10g039430.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003096 |
Alias | 10:21771604|21772311 |
Organism | Solanum lycopersicum |
Position | chr10: 21871504-21872211 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc10g039430.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Solyc10g039430.1_circ_g.1 |
Support reads | 5/3 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc10g039430.1.1:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.43895576 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21871904-21872193(-) 21871522-21872193(-) |
Potential amino acid sequence |
MFQWVRHYPDGTRQYIEGATNPEYVVTADDIDKLIAVECIPMDDQGHQGCFRSR*(-) MIRDIRDVSGPAKDNLFAINGVNERFEESNNENRHNPPTVGNDIGGSFSSEGESPGIEVFQIIG EAKPGCKLLGCGFPVRGTSLCMFQWVRHYPDGTRQYIEGATNPEYVVTADDIDKLIAVECIPMD DQGHQGCFRSR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to chilling stress; fruit ripening |
Other Information | |
---|---|
References | Zuo et al., 2016; Yin et al., 2018 |