Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G040600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000235 |
| Alias | Chr03:4839545|4840190 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 4839545-4840190 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G040600 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | No-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.003G040600.2:1 Gorai.003G040600.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.143051032 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4839883-4839563(+) |
| Potential amino acid sequence |
MEEDGEFRCWDELIPDALGLIFNNLSLQEILTVIPRVCKSWQRAVSGPYCWQDIDIEQWSQQCR PETLDRMLQMLITRSSGSLRKLCVTGLPNGQSFSFIADKYLINVV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |