Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0302200_circ_g.2 |
| ID in PlantcircBase | osa_circ_014374 |
| Alias | Os02circ11223 |
| Organism | Oryza sativa |
| Position | chr2: 11734000-11734652 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os02g0302200 |
| Parent gene annotation |
Similar to aminotransferase family protein. (Os02t0302200-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0302200_circ_g.1 |
| Support reads | 18/10 |
| Tissues | leaf and panicle/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0302200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003842* osi_circ_011572 |
| PMCS | 0.450898661 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11734095-11734094(+) |
| Potential amino acid sequence |
MMSVLASPGANVLLPRPGYPLYASRAALSGLEFRHFDLLPDSEWEVDLAGVEALADANTVAMVI VNPNNPCGCVYSRDHLAKIAETARKLGIMVISDEVYDHFAFGSKPFVPMGVFGDVAPVMTLGGI SKRWMVPGWRLGWIAATDPNGILRNKKRGGGAPVAGAPLRRLAGGRGAHRRLQPRRRDHDVRAR VAGRQRAAPAARLPAVRVARRPERPRVPPLRPPPRQRVGGRPRRRRGPRRRQHRRHGHRQPQQP LRLRLLPRPPRQDRRDGEEAGDNGDQRRGVRPLRVREQAVRADGGVRRRGAGDDAGRHLQAVDG ARLAPRLDRRHRSQRNPQEQEARWRRTCRGSSPTPSRRRTWCSPPAATTPSRS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |