Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G22990_circ_g.3 |
ID in PlantcircBase | ath_circ_023287 |
Alias | At_ciR4016, Ath_circ_FC2129 |
Organism | Arabidpsis thaliana |
Position | chr3: 8165444-8165801 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT3G22990 |
Parent gene annotation |
Armadillo repeat-containing protein LFR |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 5 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G22990.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.171463477 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8165767-8165798(+) |
Potential amino acid sequence |
MDCRLKLASERCEKKAVQAVVGILNSSVKAWNCAAAELLGRLIINPDNEPFISPLIPQIHKRLI DLLSIQAVDAQAAAVGALYNLVEVNMDCRLKLASERCEKKAVQAVVGILNSSVKAWNCAAAELL GRLIINPDNEPFISPLIPQIHKRLIDLLSIQAVDAQAAAVGALYNLVEVNMDCRLKLASERCEK KAVQAVVGILNSSVKAWNCAAAELLGRLIINPDNEPFISPLIPQIHKRLIDLLSIQAVDAQAAA VGALYNLVEVNMDCRLKLASER(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chen et al., 2017a |