Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G22990_circ_g.3 |
| ID in PlantcircBase | ath_circ_023287 |
| Alias | At_ciR4016, Ath_circ_FC2129 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 8165444-8165801 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT3G22990 |
| Parent gene annotation |
Armadillo repeat-containing protein LFR |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G22990.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.171463477 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8165767-8165798(+) |
| Potential amino acid sequence |
MDCRLKLASERCEKKAVQAVVGILNSSVKAWNCAAAELLGRLIINPDNEPFISPLIPQIHKRLI DLLSIQAVDAQAAAVGALYNLVEVNMDCRLKLASERCEKKAVQAVVGILNSSVKAWNCAAAELL GRLIINPDNEPFISPLIPQIHKRLIDLLSIQAVDAQAAAVGALYNLVEVNMDCRLKLASERCEK KAVQAVVGILNSSVKAWNCAAAELLGRLIINPDNEPFISPLIPQIHKRLIDLLSIQAVDAQAAA VGALYNLVEVNMDCRLKLASER(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chen et al., 2017a |