Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G148700_circ_g.1 |
| ID in PlantcircBase | gra_circ_001408 |
| Alias | Chr13:40828749|40828950 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 40828749-40828950 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G148700 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/19 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.013G148700.2:2 Gorai.013G148700.3:2 Gorai.013G148700.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000462 |
| PMCS | 1.109321741 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40828899-40828751(-) |
| Potential amino acid sequence |
MALKSTLSSTGFFQGVKQHDPSPQASAERSAPLKFSQASIRPMALKSTLSSTGFFQGVKQHDPS PQASAERSAPLKFSQASIRPMALKSTLSSTGFFQGVKQHDPSPQASAERSAPLKFSQASIRPMA LKSTLSSTGFFQGVKQHDPSPQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |