logo





circRNA ID
Zm00001d023705_circ_g.1
Alias
zma_circ_006429, Zm10circ00013
Organism
Zea mays
Position
chr10: 16372561-16372819  JBrowse»
Reference genome
AGPv4.38
Type  
e-circRNA
Identification method
CIRI, CIRCexplor2
Parent gene
Zm00001d023705
Parent gene annotation
DNA-directed DNA polymerases
Parent gene strand
+
Alternative splicing
NA
Splice junction sequence  
AGCTACTGCTGATGCACAAATTTGTGCGAAGGAAGAAGCAGATGGAAATAGCAGCGATGATGAA
CATGGGATAAAGTACAAGAGGGGATCCACTAATGCActacagctgtagcaagtgttgcaggtat
tatctcacaaatgttcgtattcaaattctttgtgctttactttctcgtctataattctcagcac
acatctag
Support reads
NA
Tissues
leaf
Exon boundary  
No-No
Splicing signals  
AA-TT
Sanger sequencing for BSS  
NA
PCR primers for BSS  
NA
Assembled circRNA sequence  
NA
Sanger sequencing for FL  
NA
PCR primers for FL  
NA
Genomic sequence
CTACAGCTGTAGCAAGTGTTGCAGGTATTATCTCACAAATGTTCGTATTCAAATTCTTTGTGCT
TTACTTTCTCGTCTATAATTCTCAGCACACATCTAGTCCTGTATATCAACCCTTTACAGGCATG
CTAATATAGAACTAATGCTGTTAATATTTTCAGCTACTGCTGATGCACAAATTTGTGCGAAGGA
AGAAGCAGATGGAAATAGCAGCGATGATGAACATGGGATAAAGTACAAGAGGGGATCCACTAAT
GCA
Number of exons covered
Zm00001d023705_T001:2
Conserved circRNAs
NA
Coding potential
Y
Potential coding position
16375856-16372569(+)
16375968-16372639(+)
Potential amino acid sequence
MLLIFSATADAQICAKEEADGNSSDDEHGIKYKRGSTNALQL*
MHYSCSKCCRYYLTNVRIQILCALLSRL*
Sponge-miRNAs
NA
circRNA-miRNA-mRNA network
References
Han et al., 2020

Copyright©2017-2021 Institute of Crop Sciences / Institute of Bioinformatics, Zhejiang University.
Any questions or suggestions, please contact the Fan's lab, bioinplant@zju.edu.cn
For submittion, please click here. Last modified at 2021-03-09.

Supported by   nsfc    zju