Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0225200_circ_g.3 |
| ID in PlantcircBase | osa_circ_000909 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 6902079-6902216 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0225200 |
| Parent gene annotation |
Similar to predicted protein. (Os01t0225200-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0225200_circ_g.1 Os01g0225200_circ_g.2 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0225200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.397347524 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6902104-6902213(+) 6902142-6902161(-) |
| Potential amino acid sequence |
MSALEGRGRIAVMRQVIDTYEKWCLRLSTSRLNRWLRKVTGIPVVFMSALEGRGRIAVMRQVID TYEKWCLRLSTSRLNRWLRKVTGIPVVFMSALEGRGRIAVMRQVIDTYEKWCLRLSTSRLNRWL RKVTGIPVVFMSALEGRGRIAVMRQVIDTYEKWCLRLSTSRLNRWLRK(+) MTAIRPLPSNADINTTGIPVTLRNQRFSREVDNLKHHFS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |