Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0225200_circ_g.3 |
ID in PlantcircBase | osa_circ_000909 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 6902079-6902216 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os01g0225200 |
Parent gene annotation |
Similar to predicted protein. (Os01t0225200-01) |
Parent gene strand | + |
Alternative splicing | Os01g0225200_circ_g.1 Os01g0225200_circ_g.2 |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0225200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.397347524 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6902104-6902213(+) 6902142-6902161(-) |
Potential amino acid sequence |
MSALEGRGRIAVMRQVIDTYEKWCLRLSTSRLNRWLRKVTGIPVVFMSALEGRGRIAVMRQVID TYEKWCLRLSTSRLNRWLRKVTGIPVVFMSALEGRGRIAVMRQVIDTYEKWCLRLSTSRLNRWL RKVTGIPVVFMSALEGRGRIAVMRQVIDTYEKWCLRLSTSRLNRWLRK(+) MTAIRPLPSNADINTTGIPVTLRNQRFSREVDNLKHHFS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |