Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0401300_circ_g.12 |
| ID in PlantcircBase | osa_circ_020230 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 16303061-16303427 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0401300 |
| Parent gene annotation |
Sucrose synthase 2 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferas e 2). (Os03t0401300-01);Similar to Sucrose synthase 1. (Os03t040 1300-02);Similar to Sucrose synthase metabolism (Fragment). (Os0 3t0401300-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0401300_circ_g.13 Os03g0401300_circ_g.14 Os03g0401300_circ_g.15 Os03g0401300_circ_g.16 Os03g0401300_circ_g.17 Os03g0401300_circ_g.18 Os03g0401300_circ_g.19 Os03g0401300_circ_g.20 Os03g0401300_circ_g.21 Os03g0401300_circ_g.22 Os03g0401300_circ_g.23 Os03g0401300_circ_g.24 Os03g0401300_circ_g.25 Os03g0401300_circ_g.26 Os03g0401300_circ_g.27 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0401333-00:2 Os03t0401333-00:2 Os03t0401300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.538554905 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16303376-16303088(+) 16303214-16303150(+) 16303327-16303381(-) |
| Potential amino acid sequence |
MIKSGLAWSSPAISCATSFRQSLGRYW*(+) MGNGTMGNTHLVCKQACNKVSVTVVSDDQVRIGLELSSNFVRDIFPAISWKVLVMMKSAWFIAI KSVVNWHEKW*(+) MGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADFIITSTFQEIAGKMSR TKLLESSRPILT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |