Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0725300_circ_g.1 |
| ID in PlantcircBase | osa_circ_016369 |
| Alias | Os_ciR8059 |
| Organism | Oryza sativa |
| Position | chr2: 30151480-30151620 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0725300 |
| Parent gene annotation |
Cellulose synthase family protein. (Os02t0725300-01);Similar to cDNA clone:J033042D19, full insert sequence. (Os02t0725300-02);S imilar to cDNA clone:J033042D19, full insert sequence. (Os02t072 5300-03);Similar to cDNA clone:J033042D19, full insert sequence. (Os02t0725300-04) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0725300-01:1 Os02t0725300-04:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.095153664 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30151496-30151617(+) |
| Potential amino acid sequence |
MTDRVNSVVNSGRIPEVPRCHSRGFSQWNENFTSSDHPSIVQELYKDMTDRVNSVVNSGRIPEV PRCHSRGFSQWNENFTSSDHPSIVQELYKDMTDRVNSVVNSGRIPEVPRCHSRGFSQWNENFTS SDHPSIVQELYKDMTDRVNSVVNSGRIPEVPRCHSRGFSQWNENFTSSDHPSIVQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |