Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0725300_circ_g.1 |
ID in PlantcircBase | osa_circ_016369 |
Alias | Os_ciR8059 |
Organism | Oryza sativa |
Position | chr2: 30151480-30151620 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os02g0725300 |
Parent gene annotation |
Cellulose synthase family protein. (Os02t0725300-01);Similar to cDNA clone:J033042D19, full insert sequence. (Os02t0725300-02);S imilar to cDNA clone:J033042D19, full insert sequence. (Os02t072 5300-03);Similar to cDNA clone:J033042D19, full insert sequence. (Os02t0725300-04) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0725300-01:1 Os02t0725300-04:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.095153664 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30151496-30151617(+) |
Potential amino acid sequence |
MTDRVNSVVNSGRIPEVPRCHSRGFSQWNENFTSSDHPSIVQELYKDMTDRVNSVVNSGRIPEV PRCHSRGFSQWNENFTSSDHPSIVQELYKDMTDRVNSVVNSGRIPEVPRCHSRGFSQWNENFTS SDHPSIVQELYKDMTDRVNSVVNSGRIPEVPRCHSRGFSQWNENFTSSDHPSIVQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |