Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G122600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000613 |
| Alias | Chr06:37410381|37410749 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 37410381-37410749 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G122600 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.006G122500_circ_ag.1 |
| Support reads | 3/4 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G122600.1:2 Gorai.006G122600.2:2 Gorai.006G122600.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.894851242 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37410704-37410387(+) 37410383-37410387(+) |
| Potential amino acid sequence |
MLIRKLSFCSSFEFEEMGEEAKAVVPESLLKKNKRNEEWELAKKQELEVAKKKKVENRKLIYSR AKQYAKEYGAQEKELIQLKREARLKGGFYVDPEAKLLFIIRIRGDG*(+) MGEEAKAVVPESLLKKNKRNEEWELAKKQELEVAKKKKVENRKLIYSRAKQYAKEYGAQEKELI QLKREARLKGGFYVDPEAKLLFIIRIRGDG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |