Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G51370_circ_g.2 |
| ID in PlantcircBase | ath_circ_006770 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 19046581-19046721 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G51370 |
| Parent gene annotation |
F-box/FBD/LRR-repeat protein At1g51370 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G51370.2:1 AT1G51370.1:1 AT1G51370.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.158984047 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19046671-19046718(+) |
| Potential amino acid sequence |
MLPTLLESCPKLESLILEFFLYSKSRPLLQFRYISHLNARFYISDLEMLPTLLESCPKLESLIL EFFLYSKSRPLLQFRYISHLNARFYISDLEMLPTLLESCPKLESLILEFFLYSKSRPLLQFRYI SHLNARFYISDLEMLPTLLESCPKLESLIL(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |