Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0246800_circ_g.2 |
| ID in PlantcircBase | osa_circ_036513 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 8969747-8969952 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0246800 |
| Parent gene annotation |
Conserved hypothetical protein. (Os08t0246800-01);Hypothetical c onserved gene. (Os08t0246800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0246800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.376569579 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8969768-8969839(+) |
| Potential amino acid sequence |
MASKPKGIELKRKEICGSARPIGGLEKSSQNGKKKKNDDSPAEVVELQPVTEMQPQPYATVLLQ KEIRSWLVNQKALSSRERKFVVQLDLLVA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |